Lineage for d2bm4a1 (2bm4 A:2-182)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
superhelix turns are made of parallel beta-strands and (short) turns
Superfamily b.80.8: Pentapeptide repeat-like [141571] (2 families) 
superhelix turns are made of four short strands each; duplication: the sequence pentapeptide repeats correspond to individual strandsFamily b.80.8.1: Pentapeptide repeats [141572] (4 proteins)
Pfam PF00805 (covers eight repeats or two full superhelical turns)
this is a repeat family; one repeat unit is 2bm4 A:81-101 found in domain
Protein Hypothetical protein Rv3361c (MT3469) [141573] (1 species) Species Mycobacterium tuberculosis [TaxId:1773] [141574] (1 PDB entry)
Uniprot O50390 2-182
Domain d2bm4a1: 2bm4 A:2-182 [128763]
Other proteins in same PDB: d2bm4b_
Details for d2bm4a1
PDB Entry: 2bm4 (more details), 2.2 Å
PDB Description: the structure of mfpa (rv3361c, c2 crystal form). the pentapeptide repeat protein from mycobacterium tuberculosis folds as a right-handed quadrilateral beta-helix.
PDB Compounds: (A:) pentapeptide repeat family proteinSCOPe Domain Sequences for d2bm4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bm4a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]}
qqwvdceftgrdfrdedlsrlhteramfsecdfsgvnlaesqhrgsafrnctferttlwh
stfaqcsmlgsvfvacrlrpltlddvdftlavlggndlrglnltgcrlretslvdtdlrk
cvlrgadlsgarttgarlddadlrgatvdpvlwrtaslvgarvdvdqavafaaahglcla
g
SCOPe Domain Coordinates for d2bm4a1:
Click to download the PDB-style file with coordinates for d2bm4a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bm4a1:
- d2bm4a1 first appeared in SCOP 1.73
- d2bm4a1 appears in SCOPe 2.04
- d2bm4a1 appears in SCOPe 2.06
- d2bm4a1 appears in the current release, SCOPe 2.08
View in 3D
