Lineage for d2bj7a1 (2bj7 A:1-50)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998574Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 1998575Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 1998617Family a.43.1.3: CopG-like [100970] (4 proteins)
    similar to the phage repressor family
  6. 1998618Protein Nickel responsive regulator NikR, N-terminal domain [101205] (2 species)
  7. 1998636Species Pyrococcus horikoshii [TaxId:53953] [140543] (4 PDB entries)
    Uniprot O58316 1-50
  8. 1998637Domain d2bj7a1: 2bj7 A:1-50 [128608]
    Other proteins in same PDB: d2bj7a2, d2bj7b2
    automated match to d2bj1a1
    complexed with cl, edo, ni, pg4

Details for d2bj7a1

PDB Entry: 2bj7 (more details), 2.1 Å

PDB Description: nikr in closed conformation and nickel bound to high-affinity sites
PDB Compounds: (A:) nickel responsive regulator

SCOPe Domain Sequences for d2bj7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bj7a1 a.43.1.3 (A:1-50) Nickel responsive regulator NikR, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
melirfsisipskllekfdqiieeigyenrseairdlirdfiirhewevg

SCOPe Domain Coordinates for d2bj7a1:

Click to download the PDB-style file with coordinates for d2bj7a1.
(The format of our PDB-style files is described here.)

Timeline for d2bj7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bj7a2