Lineage for d2bj1a2 (2bj1 A:51-132)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.18: ACT-like [55021] (15 families) 
regulatory domain linked to a wide range of metabolic enzymesFamily d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (2 proteins)
automatically mapped to Pfam PF08753Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species) 
Species Pyrococcus horikoshii [TaxId:53953] [143375] (4 PDB entries)
Uniprot O58316 51-132
Domain d2bj1a2: 2bj1 A:51-132 [128597]
Other proteins in same PDB: d2bj1a1, d2bj1b1, d2bj1b2
complexed with cl, ni
Details for d2bj1a2
PDB Entry: 2bj1 (more details), 3 Å
PDB Description: nikr in open conformation and nickel bound to high-affinity sites
PDB Compounds: (A:) nickel responsive regulatorSCOPe Domain Sequences for d2bj1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bj1a2 d.58.18.4 (A:51-132) Nickel responsive regulator NikR, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
neevagtitivynhdegdvvkalldlqheyldeiisslhvhmdehnclevivvkgeakki
kmiadkllslkgvkhgklvmts
SCOPe Domain Coordinates for d2bj1a2:
Click to download the PDB-style file with coordinates for d2bj1a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bj1a2:
- d2bj1a2 first appeared in SCOP 1.73
- d2bj1a2 appears in SCOPe 2.07
View in 3D
