Lineage for d2bija1 (2bij A:258-537)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) 
share with the family I the common active site structure with a circularly permuted topologyFamily c.45.1.0: automated matches [191381] (1 protein)
not a true familyProtein automated matches [190475] (10 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187400] (140 PDB entries) 
Domain d2bija1: 2bij A:258-537 [203604]
Other proteins in same PDB: d2bija2
automated match to d3o4ua_
complexed with so4
Details for d2bija1
PDB Entry: 2bij (more details), 2.05 Å
PDB Description: crystal structure of the human protein tyrosine phosphatase ptpn5 (step, striatum enriched enriched phosphatase)
PDB Compounds: (A:) tyrosine-protein phosphatase, non-receptor type 5SCOPe Domain Sequences for d2bija1:
Sequence, based on SEQRES records: (download)
>d2bija1 c.45.1.0 (A:258-537) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srvlqaeelhekaldpfllqaeffeipmnfvdpkeydipglvrknryktilpnphsrvcl
tspdpddplssyinanyirgyggeekvyiatqgpivstvadfwrmvwqehtpiivmitni
eemnekcteywpeeqvaydgveitvqkvihtedyrlrlislksgteerglkhywftswpd
qktpdrappllhlvreveeaaqqegphcapiivhcsagigrtgcfiatsiccqqlrqegv
vdilkttcqlrqdrggmiqtceqyqfvhhvmslyekqlsh
Sequence, based on observed residues (ATOM records): (download)
>d2bija1 c.45.1.0 (A:258-537) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srvlqaeelhekaldpfllqaeffeipmnfvdpkeydipglvrknryktilpnphsrvcl
tspdpddplssyinanyirgyggeekvyiatqgpivstvadfwrmvwqehtpiivmitni
eekcteywpeeqvaydgveitvqkvihtedyrlrlislksgteerglkhywftswpdqkt
pdrappllhlvreveeaaqqegphcapiivhcsagigrtgcfiatsiccqqlrqegvvdi
lkttcqlrqdrggmiqtceqyqfvhhvmslyekqlsh
SCOPe Domain Coordinates for d2bija1:
Click to download the PDB-style file with coordinates for d2bija1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bija1:
- d2bija1 first appeared in SCOPe 2.03, called d2bija_
- d2bija1 appears in SCOPe 2.07
View in 3D
