Lineage for d2bhka_ (2bhk A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033932Family g.17.1.0: automated matches [191392] (1 protein)
    not a true family
  6. 3033933Protein automated matches [190506] (3 species)
    not a true protein
  7. 3033934Species Human (Homo sapiens) [TaxId:9606] [187459] (39 PDB entries)
  8. 3033976Domain d2bhka_: 2bhk A: [163084]
    automated match to d3bmpa_
    complexed with ipa

Details for d2bhka_

PDB Entry: 2bhk (more details), 2.4 Å

PDB Description: crystal structure of human growth and differentiation factor 5 (gdf5)
PDB Compounds: (A:) growth differentiation factor 5

SCOPe Domain Sequences for d2bhka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bhka_ g.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
karcsrkalhvnfkdmgwddwiiapleyeafhceglcefplrshleptnhaviqtlmnsm
dpestpptccvptrlspisilfidsannvvykqyedmvvescgcr

SCOPe Domain Coordinates for d2bhka_:

Click to download the PDB-style file with coordinates for d2bhka_.
(The format of our PDB-style files is described here.)

Timeline for d2bhka_: