Lineage for d2bf2b_ (2bf2 B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
corner-like structure formed by two sheets and filled in with 2-3 helicesSuperfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) 
duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like foldFamily d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins)
note: the solution structure determinations disagree in the relative orientations of two motifsProtein Toluene-4-monooxygenase catalytic effector protein [64394] (1 species) Species Pseudomonas mendocina [TaxId:300] [64395] (18 PDB entries) 
Domain d2bf2b_: 2bf2 B: [128404]
automated match to d1g10a_
Details for d2bf2b_
PDB Entry: 2bf2 (more details), 2.1 Å
PDB Description: crystal structure of native toluene-4-monooxygenase catalytic effector protein, t4mod
PDB Compounds: (B:) toluene-4-monooxygenase system protein dSCOPe Domain Sequences for d2bf2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bf2b_ d.137.1.1 (B:) Toluene-4-monooxygenase catalytic effector protein {Pseudomonas mendocina [TaxId: 300]}
adqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltrktl
eeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm
SCOPe Domain Coordinates for d2bf2b_:
Click to download the PDB-style file with coordinates for d2bf2b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bf2b_:
- d2bf2b_ first appeared in SCOP 1.73, called d2bf2b1
- d2bf2b_ appears in SCOPe 2.07
View in 3D
