Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins) |
Protein automated matches [254486] (1 species) not a true protein |
Species Listeria monocytogenes [TaxId:169963] [255050] (2 PDB entries) |
Domain d2beoa1: 2beo A:138-237 [128381] Other proteins in same PDB: d2beoa2, d2beob2 automated match to d2beoa1 complexed with acm, cl, gln, pg4 |
PDB Entry: 2beo (more details), 2.7 Å
SCOPe Domain Sequences for d2beoa1:
Sequence, based on SEQRES records: (download)
>d2beoa1 a.4.5.4 (A:138-237) automated matches {Listeria monocytogenes [TaxId: 169963]} gklgsicgqlliltyvygketpdgikitldnltmqelgyssgiahssavsriisklkqek vivyknscfyvqnldylkryapkldewfylacpatwgkln
>d2beoa1 a.4.5.4 (A:138-237) automated matches {Listeria monocytogenes [TaxId: 169963]} gklgsicgqlliltyvygketpdgikitldnltmqelavsriisklkqekvivyknscfy vqnldylkryapkldewfylacpatwgkln
Timeline for d2beoa1: