Lineage for d2bema_ (2bem A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937486Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 937592Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 937617Protein Chitin-binding protein CBP21 [117045] (1 species)
    member of Pfam PF03067; elaborated fold with a large insertion between strands A and A'
  7. 937618Species Serratia marcescens [TaxId:615] [117046] (2 PDB entries)
    Uniprot O83009 28-197
  8. 937619Domain d2bema_: 2bem A: [116698]
    complexed with edo, na, so4

Details for d2bema_

PDB Entry: 2bem (more details), 1.55 Å

PDB Description: crystal structure of the serratia marcescens chitin-binding protein cbp21
PDB Compounds: (A:) cbp21

SCOPe Domain Sequences for d2bema_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bema_ b.1.18.2 (A:) Chitin-binding protein CBP21 {Serratia marcescens [TaxId: 615]}
hgyvespasrayqcklqlntqcgsvqyepqsveglkgfpqagpadghiasadkstffeld
qqtptrwnklnlktgpnsftwkltarhsttswryfitkpnwdasqpltrasfdltpfcqf
ndggaipaaqvthqcnipadrsgshvilavwdiadtanafyqaidvnlsk

SCOPe Domain Coordinates for d2bema_:

Click to download the PDB-style file with coordinates for d2bema_.
(The format of our PDB-style files is described here.)

Timeline for d2bema_: