Lineage for d2bdwb_ (2bdw B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPK
Family d.144.1.0: automated matches [191359] (1 protein)
not a true familyProtein automated matches [190417] (37 species)
not a true protein
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225832] (2 PDB entries) 
Domain d2bdwb_: 2bdw B: [241309]
automated match to d2wela_
Details for d2bdwb_
PDB Entry: 2bdw (more details), 1.8 Å
PDB Description: crystal structure of the auto-inhibited kinase domain of calcium/calmodulin activated kinase ii
PDB Compounds: (B:) Hypothetical protein K11E8.1dSCOPe Domain Sequences for d2bdwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bdwb_ d.144.1.0 (B:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
fsdnydvkeelgkgafsvvrrcvhkttglefaakiintkklsardfqklerearicrklq
hpnivrlhdsiqeesfhylvfdlvtggelfedivarefyseadashciqqilesiaychs
ngivhrnlkpenlllaskakgaavkladfglaievndseawhgfagtpgylspevlkkdp
yskpvdiwacgvilyillvgyppfwdedqhrlyaqikagaydypspewdtvtpeakslid
smltvnpkkritadqalkvpwicnrervasaihrqdtvdclkkfnarrklkgailttmia
trnlsnlgr
SCOPe Domain Coordinates for d2bdwb_:
Click to download the PDB-style file with coordinates for d2bdwb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bdwb_:
- d2bdwb_ first appeared in SCOPe 2.04
- d2bdwb_ appears in SCOPe 2.07
View in 3D
