Lineage for d2bc3a_ (2bc3 A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.61: Streptavidin-like [50875] (8 superfamilies)
barrel, closed; n=8, S=10; meanderSuperfamily b.61.1: Avidin/streptavidin [50876] (2 families) 
Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) 
Protein automated matches [190191] (2 species)
not a true proteinSpecies Streptomyces avidinii [TaxId:1895] [189343] (34 PDB entries) 
Domain d2bc3a_: 2bc3 A: [128279]
automated match to d2bc3b_
complexed with gol, so4
Details for d2bc3a_
PDB Entry: 2bc3 (more details), 1.54 Å
PDB Description: t7-tagged full-length streptavidin
PDB Compounds: (A:) streptavidinSCOPe Domain Sequences for d2bc3a_:
Sequence, based on SEQRES records: (download)
>d2bc3a_ b.61.1.1 (A:) automated matches {Streptomyces avidinii [TaxId: 1895]}
deagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkpsaasidaakkagvnngnpldavqq
Sequence, based on observed residues (ATOM records): (download)
>d2bc3a_ b.61.1.1 (A:) automated matches {Streptomyces avidinii [TaxId: 1895]}
deagitgtwynqlgstfivtagadgaltgtyesgnaesryvltgrydsapatdgsgtalg
wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
psaasidaakkagvnngnpldavqq
SCOPe Domain Coordinates for d2bc3a_:
Click to download the PDB-style file with coordinates for d2bc3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bc3a_:
- d2bc3a_ first appeared in SCOP 1.73, called d2bc3a1
- d2bc3a_ was called d2bc3a1 in SCOPe 2.04
- d2bc3a_ is called d2bc3a2 in SCOPe 2.06
- d2bc3a_ appears in the current release, SCOPe 2.08, called d2bc3a2
View in 3D
