Lineage for d2bbkl_ (2bbk L:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1243277Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 1243278Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 1243279Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
  6. 1243280Protein Methylamine dehydrogenase [57563] (2 species)
  7. 1243281Species Paracoccus denitrificans [TaxId:266] [57564] (6 PDB entries)
  8. 1243282Domain d2bbkl_: 2bbk L: [44882]
    Other proteins in same PDB: d2bbkh_, d2bbkj_

Details for d2bbkl_

PDB Entry: 2bbk (more details), 1.75 Å

PDB Description: crystal structure of the quinoprotein methylamine dehydrogenase from paracoccus denitrificans at 1.75 angstroms
PDB Compounds: (L:) methylamine dehydrogenase (light subunit)

SCOPe Domain Sequences for d2bbkl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bbkl_ g.21.1.1 (L:) Methylamine dehydrogenase {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d2bbkl_:

Click to download the PDB-style file with coordinates for d2bbkl_.
(The format of our PDB-style files is described here.)

Timeline for d2bbkl_: