Lineage for d2bb0a2 (2bb0 A:74-373)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1820872Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 1821439Family c.1.9.17: Imidazolonepropionase-like [159400] (3 proteins)
    automatically mapped to Pfam PF13147
  6. 1821440Protein Imidazolonepropionase [159405] (2 species)
  7. 1821446Species Bacillus subtilis [TaxId:1423] [159406] (2 PDB entries)
    Uniprot P42084 74-373
  8. 1821449Domain d2bb0a2: 2bb0 A:74-373 [146130]
    Other proteins in same PDB: d2bb0a1, d2bb0b1
    complexed with act, zn

Details for d2bb0a2

PDB Entry: 2bb0 (more details), 2 Å

PDB Description: structure of imidazolonepropionase from bacillus subtilis
PDB Compounds: (A:) Imidazolonepropionase

SCOPe Domain Sequences for d2bb0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bb0a2 c.1.9.17 (A:74-373) Imidazolonepropionase {Bacillus subtilis [TaxId: 1423]}
pglvdphthlvfggsrekemnlklqgisyldilaqgggilstvkdtraaseeellqkahf
hlqrmlsygtttaevksgygleketelkqlrvakklhesqpvdlvstfmgahaippeyqn
dpddfldqmlsllpeikeqelasfadiftetgvftvsqsrrylqkaaeagfglkihadei
dplggaelagklkavsadhlvgtsdegikklaeagtiavllpgttfylgkstyararami
degvcvslatdfnpgsspteniqlimsiaalhlkmtaeeiwhavtvnaayaigkgeeagq

SCOPe Domain Coordinates for d2bb0a2:

Click to download the PDB-style file with coordinates for d2bb0a2.
(The format of our PDB-style files is described here.)

Timeline for d2bb0a2:

1821449
d2bb0a2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2bb0a1