Lineage for d2basa1 (2bas A:2-262)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.33: EAL domain-like [141868] (1 family) 
variant of the beta/alpha-barrel fold with strand 1 being antiparallel to the rest
automatically mapped to Pfam PF00563Family c.1.33.1: EAL domain [141869] (1 protein)
Pfam PF00563Protein Hypothetical protein YkuI, N-terminal domain [141870] (1 species) Species Bacillus subtilis [TaxId:1423] [141871] (2 PDB entries)
Uniprot O35014 2-262
Domain d2basa1: 2bas A:2-262 [128244]
Other proteins in same PDB: d2basa2, d2basb2, d2basb3
complexed with bme
Details for d2basa1
PDB Entry: 2bas (more details), 2.61 Å
PDB Description: crystal structure of the bacillus subtilis ykui protein, with an eal domain.
PDB Compounds: (A:) YkuI proteinSCOPe Domain Sequences for d2basa1:
Sequence, based on SEQRES records: (download)
>d2basa1 c.1.33.1 (A:2-262) Hypothetical protein YkuI, N-terminal domain {Bacillus subtilis [TaxId: 1423]}
ldpldiltniddvlpyyqaifsaeeqkvvgyevlgriladseiqslgpffldagipeeyk
levdnriirqaldrfleadsdllifmnqdanllmldhgesflellkeyeakgielhrfvl
eitehnfegdieqlyhmlayyrtygikiavdnigkessnldriallspdllkidlqalkv
sqpspsyehvlysisllarkigaallyedieanfqlqyawrnggryfqgyylvspsetfl
erdvlkqrlktefhqfithek
Sequence, based on observed residues (ATOM records): (download)
>d2basa1 c.1.33.1 (A:2-262) Hypothetical protein YkuI, N-terminal domain {Bacillus subtilis [TaxId: 1423]}
ldpldiltniddvlpyyqaifsaeeqkvvgyevlgriladseiqslgpffldagipeeyk
levdnriirqaldrfleadsdllifmnqdanllmldhgesflellkeyeakgielhrfvl
eitehnfegdieqlyhmlayyrtygikiavdnigkessnldriallspdllkidlqalks
psyehvlysisllarkigaallyedieanfqlqyawrnggryfqgyylvspsetflerdv
lkqrlktefhqfithek
SCOPe Domain Coordinates for d2basa1:
Click to download the PDB-style file with coordinates for d2basa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2basa1:
- d2basa1 first appeared in SCOP 1.73
- d2basa1 appears in SCOPe 2.07
View in 3D
