Lineage for d2bapa1 (2bap A:135-435)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. Family a.118.1.23: Diap1 N-terninal region-like [140830] (2 proteins)
    contains two consequitive Pfam domains in one superhelical segment: Pfam PF06371 and Pfam PF06367
    this is a repeat family; one repeat unit is 2bap A:217-262 found in domain
  6. Protein Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) [140831] (1 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [140832] (4 PDB entries)
    Uniprot O08808 133-475! Uniprot O08808 135-435! Uniprot O08808 83-443
  8. Domain d2bapa1: 2bap A:135-435 [128242]

Details for d2bapa1

PDB Entry: 2bap (more details), 3.3 Å

PDB Description: crystal structure of the n-terminal mdia1 armadillo repeat region and dimerisation domain in complex with the mdia1 autoregulatory domain (dad)
PDB Compounds: (A:) Diaphanous protein homolog 1

SCOPe Domain Sequences for d2bapa1:

Sequence, based on SEQRES records: (download)

>d2bapa1 a.118.1.23 (A:135-435) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]}
sammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlhdeke
etsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmidaakll
salcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlinalit
paeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgrlddi
rmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvsqivl
h

Sequence, based on observed residues (ATOM records): (download)

>d2bapa1 a.118.1.23 (A:135-435) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]}
sammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlhdeky
dsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmidaakllsalcil
pqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlinalitpaeeld
frvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgrlddirmemdd
fgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvsqivlh

SCOPe Domain Coordinates for d2bapa1 are not available.

Timeline for d2bapa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bapb1