![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.30: MPN010-like [144266] (1 family) ![]() segmented trimeric coiled coil |
![]() | Family h.1.30.1: MPN010-like [144267] (1 protein) Pfam PF01519; DUF16 |
![]() | Protein Hypothetical protein MPN010 [144268] (1 species) |
![]() | Species Mycoplasma pneumoniae [TaxId:2104] [144269] (1 PDB entry) Uniprot P75103 50-130 |
![]() | Domain d2ba2a1: 2ba2 A:5-85 [128233] |
PDB Entry: 2ba2 (more details), 1.8 Å
SCOPe Domain Sequences for d2ba2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ba2a1 h.1.30.1 (A:5-85) Hypothetical protein MPN010 {Mycoplasma pneumoniae [TaxId: 2104]} gtryvthkqldeklknfvtktefkefqtvvmesfavqnqnidaqgeqikelqveqkaqgk tlqlilealqginkrldnles
Timeline for d2ba2a1: