Lineage for d2ba2a1 (2ba2 A:5-85)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040622Superfamily h.1.30: MPN010-like [144266] (1 family) (S)
    segmented trimeric coiled coil
  5. 3040623Family h.1.30.1: MPN010-like [144267] (1 protein)
    Pfam PF01519; DUF16
  6. 3040624Protein Hypothetical protein MPN010 [144268] (1 species)
  7. 3040625Species Mycoplasma pneumoniae [TaxId:2104] [144269] (1 PDB entry)
    Uniprot P75103 50-130
  8. 3040626Domain d2ba2a1: 2ba2 A:5-85 [128233]

Details for d2ba2a1

PDB Entry: 2ba2 (more details), 1.8 Å

PDB Description: Crystal structure of the DUF16 domain of MPN010 from Mycoplasma pneumoniae
PDB Compounds: (A:) Hypothetical UPF0134 protein MPN010

SCOPe Domain Sequences for d2ba2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ba2a1 h.1.30.1 (A:5-85) Hypothetical protein MPN010 {Mycoplasma pneumoniae [TaxId: 2104]}
gtryvthkqldeklknfvtktefkefqtvvmesfavqnqnidaqgeqikelqveqkaqgk
tlqlilealqginkrldnles

SCOPe Domain Coordinates for d2ba2a1:

Click to download the PDB-style file with coordinates for d2ba2a1.
(The format of our PDB-style files is described here.)

Timeline for d2ba2a1: