Lineage for d2b9za1 (2b9z A:1-72)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1086923Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 1087017Superfamily a.30.8: FHV B2 protein-like [140506] (1 family) (S)
  5. 1087018Family a.30.8.1: FHV B2 protein-like [140507] (1 protein)
  6. 1087019Protein B2 [140508] (1 species)
  7. 1087020Species Flock house virus, FHV [TaxId:12287] [140509] (3 PDB entries)
    Uniprot P68831 1-72! Uniprot P68831 2-71
  8. 1087025Domain d2b9za1: 2b9z A:1-72 [128231]

Details for d2b9za1

PDB Entry: 2b9z (more details)

PDB Description: solution structure of fhv b2, a viral suppressor of rnai
PDB Compounds: (A:) B2 protein

SCOPe Domain Sequences for d2b9za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9za1 a.30.8.1 (A:1-72) B2 {Flock house virus, FHV [TaxId: 12287]}
mpsklaliqelpdriqtaveaamgmsyqdapnnvrrdldnlhaclnkakltvgrmvtsll
ekpsvvaylegk

SCOPe Domain Coordinates for d2b9za1:

Click to download the PDB-style file with coordinates for d2b9za1.
(The format of our PDB-style files is described here.)

Timeline for d2b9za1: