Lineage for d2b6ca1 (2b6c A:3-215)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 921849Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 921850Superfamily a.118.1: ARM repeat [48371] (24 families) (S)
  5. 922147Family a.118.1.17: BC3264-like [109965] (2 proteins)
    Pfam PF06352; DUF1061
    this is a repeat family; one repeat unit is 1t06 A:120-163 found in domain
  6. 922152Protein Hypothetical protein EF3068 [140817] (1 species)
    assigned by a closer overall structural similarity to BC3264; predicted DNA alkylation repair enzyme
  7. 922153Species Enterococcus faecalis [TaxId:1351] [140818] (1 PDB entry)
    Uniprot Q82ZI8 3-215
  8. 922154Domain d2b6ca1: 2b6c A:3-215 [127983]
    complexed with bme, cl, gol, so4

Details for d2b6ca1

PDB Entry: 2b6c (more details), 2.1 Å

PDB Description: Predicted DNA alkylation repair enzyme from Enterococcus faecalis.
PDB Compounds: (A:) hypothetical protein EF3068

SCOPe Domain Sequences for d2b6ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b6ca1 a.118.1.17 (A:3-215) Hypothetical protein EF3068 {Enterococcus faecalis [TaxId: 1351]}
tlqfqknpetaakmsaymkhqfvfagipaperqalskqllkeshtwpkeklcqeieayyq
ktereyqyvaidlalqnvqrfsleevvafkayvpqkawwdsvdawrkffgswvalhltel
ptifalfygaenfwnrrvalnlqlmlkektnqdllkkaiiydrtteeffiqkaigwslrq
ysktnpqwveelmkelvlsplaqregskylaka

SCOPe Domain Coordinates for d2b6ca1:

Click to download the PDB-style file with coordinates for d2b6ca1.
(The format of our PDB-style files is described here.)

Timeline for d2b6ca1: