Lineage for d2b5ld_ (2b5l D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2243558Fold d.384: SV5-V core-like [254114] (1 superfamily)
    3 layers; central antiparallel beta sheet has 1432 topology; two loops comprise zinc finger motif
  4. 2243559Superfamily d.384.1: SV5-V core-like [254136] (1 family) (S)
    PubMed 16413485; combines Pfam PF14313 and Pfam PF13008
  5. 2243560Family d.384.1.1: SV5-V core-like [254178] (1 protein)
  6. 2243561Protein SV5-V core [254398] (1 species)
  7. 2243562Species Simian virus 5 [TaxId:11207] [254834] (2 PDB entries)
  8. 2243564Domain d2b5ld_: 2b5l D: [241268]
    Other proteins in same PDB: d2b5la1, d2b5la2, d2b5la3, d2b5la4, d2b5lb1, d2b5lb2, d2b5lb3, d2b5lb4
    complexed with zn

Details for d2b5ld_

PDB Entry: 2b5l (more details), 2.85 Å

PDB Description: Crystal Structure of DDB1 In Complex with Simian Virus 5 V Protein
PDB Compounds: (D:) Nonstructural protein V

SCOPe Domain Sequences for d2b5ld_:

Sequence, based on SEQRES records: (download)

>d2b5ld_ d.384.1.1 (D:) SV5-V core {Simian virus 5 [TaxId: 11207]}
klietglntveyftsqqvtgtsslgkntippgvtglltnaaeakiqestnhqkgsvggga
kpkkprpkiaivpaddktvpgkpipnpllgldstpstqtvldlsgktlpsgsykgvklak
fgkenlmtrfieeprenpiatsspidfkrgrdtggfhrreysigwvgdevkvtewcnpsc
spitaaarrfectchqcpvtcsecerdt

Sequence, based on observed residues (ATOM records): (download)

>d2b5ld_ d.384.1.1 (D:) SV5-V core {Simian virus 5 [TaxId: 11207]}
klietglntveyftsqqvtgtsslgkntippgvtglltnarpkiaivpaddktvpgkpip
npllgldstpstqtvldlsgktlpsgsykgvklakfgkenlmtrfieepreidfkrgrdt
ggfhrreysigwvgdevkvtewcnpscspitaaarrfectchqcpvtcsecerdt

SCOPe Domain Coordinates for d2b5ld_:

Click to download the PDB-style file with coordinates for d2b5ld_.
(The format of our PDB-style files is described here.)

Timeline for d2b5ld_: