Lineage for d2b4za_ (2b4z A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2691317Protein automated matches [190113] (17 species)
    not a true protein
  7. 2691318Species Cow (Bos taurus) [TaxId:9913] [187444] (2 PDB entries)
  8. 2691319Domain d2b4za_: 2b4z A: [162992]
    automated match to d1akka_
    complexed with hem

Details for d2b4za_

PDB Entry: 2b4z (more details), 1.5 Å

PDB Description: Crystal structure of cytochrome C from bovine heart at 1.5 A resolution.
PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d2b4za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b4za_ a.3.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gdvekgkkifvqkcaqchtvekggkhktgpnlhglfgrktgqapgfsytdanknkgitwg
eetlmeylenpkkyipgtkmifagikkkgeredliaylkkatne

SCOPe Domain Coordinates for d2b4za_:

Click to download the PDB-style file with coordinates for d2b4za_.
(The format of our PDB-style files is described here.)

Timeline for d2b4za_: