Lineage for d2b4va2 (2b4v A:30-288)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) 
Family d.218.1.10: RNA editing terminal uridyl transferase 2, RET2, catalytic domain [143236] (1 protein)
contains insert domain of a ferredoxin-like foldProtein RNA editing terminal uridyl transferase 2, TUTase 2, RET2 [143237] (1 species) Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [143238] (3 PDB entries)
Uniprot Q86MV5 30-288
Domain d2b4va2: 2b4v A:30-288 [127865]
Other proteins in same PDB: d2b4va1
protein/RNA complex; complexed with k
Details for d2b4va2
PDB Entry: 2b4v (more details), 1.8 Å
PDB Description: structural basis for utp specificity of rna editing tutases from trypanosoma brucei
PDB Compounds: (A:) RNA editing complex protein MP57SCOPe Domain Sequences for d2b4va2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b4va2 d.218.1.10 (A:30-288) RNA editing terminal uridyl transferase 2, TUTase 2, RET2 {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
npspdhyavwgkaimaennrrvgpehmfrtairaqqqlqgladkwtpdakvyccgsmvty
gqmergsdldlacmfddpypshevqakrtdklrtvikryvphylrnnllglteartpvvk
lrfandekvararytplseeedrkartalldvrnqcvgdndveyiaekmgrdnvegirvd
rttygcriaiqctskeqmieaigffpdgkimtrgmredytrdvldvrfvpemfmyrwdis
fvgygvknsylirhylhng
SCOPe Domain Coordinates for d2b4va2:
Click to download the PDB-style file with coordinates for d2b4va2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2b4va2:
- d2b4va2 first appeared in SCOP 1.73
- d2b4va2 appears in SCOPe 2.07
View in 3D
