![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.0: automated matches [191388] (1 protein) not a true family |
![]() | Protein automated matches [190497] (3 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187441] (2 PDB entries) |
![]() | Domain d2b3ra_: 2b3r A: [162989] automated match to d2bwqa1 complexed with so4 |
PDB Entry: 2b3r (more details), 2.3 Å
SCOPe Domain Sequences for d2b3ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b3ra_ b.7.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} gsgavklsvsyrngtlfimvmhikdlvtedgadpnpyvktyllpdthktskrktkisrkt rnptfnemlvysgysketlrqrelqlsvlsaeslrenfflggitlplkdfnlsketvkwy qlta
Timeline for d2b3ra_: