Lineage for d2b3ra_ (2b3r A:)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.7: C2 domain-like [49561] (5 superfamilies)
sandwich; 8 strands in 2 sheets; greek-keySuperfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) 
two constituent families are related by circular permutation
Family b.7.1.0: automated matches [191388] (1 protein)
not a true familyProtein automated matches [190497] (3 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [187441] (2 PDB entries) 
Domain d2b3ra_: 2b3r A: [162989]
automated match to d2bwqa1
complexed with so4
Details for d2b3ra_
PDB Entry: 2b3r (more details), 2.3 Å
PDB Description: Crystal structure of the C2 domain of class II phosphatidylinositide 3-kinase C2
PDB Compounds: (A:) Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing alpha polypeptideSCOPe Domain Sequences for d2b3ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b3ra_ b.7.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gsgavklsvsyrngtlfimvmhikdlvtedgadpnpyvktyllpdthktskrktkisrkt
rnptfnemlvysgysketlrqrelqlsvlsaeslrenfflggitlplkdfnlsketvkwy
qlta
SCOPe Domain Coordinates for d2b3ra_:
Click to download the PDB-style file with coordinates for d2b3ra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2b3ra_:
- d2b3ra_ first appeared in SCOPe 2.01
- d2b3ra_ appears in SCOPe 2.02
- d2b3ra_ appears in SCOPe 2.04
- d2b3ra_ appears in the current release, SCOPe 2.08, called d2b3ra1
View in 3D
