Lineage for d2b3ma1 (2b3m A:6-159)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1901753Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1901754Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1901965Family d.38.1.4: MaoC-like [82636] (6 proteins)
  6. 1902013Protein Hypothetical protein AF1124 [143171] (1 species)
  7. 1902014Species Archaeoglobus fulgidus [TaxId:2234] [143172] (2 PDB entries)
    Uniprot O29141 6-159
  8. 1902017Domain d2b3ma1: 2b3m A:6-159 [127791]

Details for d2b3ma1

PDB Entry: 2b3m (more details), 1.85 Å

PDB Description: Crystal structure of protein AF1124 from Archaeoglobus fulgidus
PDB Compounds: (A:) hypothetical protein AF1124

SCOPe Domain Sequences for d2b3ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b3ma1 d.38.1.4 (A:6-159) Hypothetical protein AF1124 {Archaeoglobus fulgidus [TaxId: 2234]}
vkmmslleemkgiyskkggkvkpfekfegelkegyrfeyekklceidvamfglisgdlnp
vhfdedfasktrfggrvvhgmlttslvsaavarlpgtvvlleqsfrytspvrigdvvrve
gvvsgveknrytidvkcytgdkvvaegvvkvliw

SCOPe Domain Coordinates for d2b3ma1:

Click to download the PDB-style file with coordinates for d2b3ma1.
(The format of our PDB-style files is described here.)

Timeline for d2b3ma1: