Lineage for d2b2na1 (2b2n A:26-333)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2870881Protein Transcription-repair coupling factor TRCF, domain 1 [418974] (1 species)
    entire protein is similar to UvrB in the N-terminal part and DEAD helicases in the C-terminal part; also contains CarD-like domain in the middle and TRCF domain at the C-terminus
  7. 2870882Species Escherichia coli [TaxId:562] [419438] (2 PDB entries)
    Uniprot P30958
  8. 2870883Domain d2b2na1: 2b2n A:26-333 [127710]
    Other proteins in same PDB: d2b2nb3
    N-terminal domain only
    complexed with na, p4c, so4
    has additional subdomain(s) that are not in the common domain

Details for d2b2na1

PDB Entry: 2b2n (more details), 2.1 Å

PDB Description: structure of transcription-repair coupling factor
PDB Compounds: (A:) Transcription-repair coupling factor

SCOPe Domain Sequences for d2b2na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b2na1 c.37.1.19 (A:26-333) Transcription-repair coupling factor TRCF, domain 1 {Escherichia coli [TaxId: 562]}
acatlvaeiaerhagpvvliapdmqnalrlhdeisqftdqmvmnladwetlpydsfsphq
diissrlstlyqlptmqrgvlivpvntlmqrvcphsflhghalvmkkgqrlsrdalrtql
dsagyrhvdqvmehgeyatrgalldlfpmgselpyrldffddeidslrvfdvdsqrtlee
veainllpahefptdkaaielfrsqwrdtfevkrdpehiyqqvskgtlpagieywqplff
seplpplfsyfpantllvntgdletsaerfqadtlarfenrgvdpmrpllppqslwlrvd
elfselkn

SCOPe Domain Coordinates for d2b2na1:

Click to download the PDB-style file with coordinates for d2b2na1.
(The format of our PDB-style files is described here.)

Timeline for d2b2na1: