![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.44: Ammonium transporter [111351] (1 superfamily) 11 transmembrane helices; duplication: consist of 2 structural repeats of five helices each plus extra C-terminal helix |
![]() | Superfamily f.44.1: Ammonium transporter [111352] (2 families) ![]() automatically mapped to Pfam PF00909 |
![]() | Family f.44.1.0: automated matches [227165] (1 protein) not a true family |
![]() | Protein automated matches [226873] (5 species) not a true protein |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [225026] (4 PDB entries) |
![]() | Domain d2b2ha_: 2b2h A: [203541] automated match to d1xqfa_ |
PDB Entry: 2b2h (more details), 1.54 Å
SCOPe Domain Sequences for d2b2ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b2ha_ f.44.1.0 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} msdgnvawilastalvmlmvpgvgffyagmvrrknavnmialsfisliitvllwifygys vsfgndisgiigglnyallsgvkgedllfmmyqmmfaavtiailtsaiaerakvssfill salwltfvyapfahwlwgggwlaklgaldfaggmvvhissgfaalavamtigkragfeey siephsipltligaallwfgwfgfnggsalaandvainavvvtntsaavagfvwmvigwi kgkpgslgivsgaiaglaaitpaagfvdvkgaiviglvagivcylamdfrikkkidesld awaihgigglwgsvavgilanpevngyagllfgnpqllvsqliavasttayaflvtlila kavdaavglrvssqeeyvgldlsqheevayt
Timeline for d2b2ha_: