![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) 6-standed beta-sheet followed with 2 helices; meander |
![]() | Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) ![]() |
![]() | Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins) |
![]() | Protein automated matches [190495] (3 species) not a true protein |
![]() | Species Enterobacteria phage [TaxId:12022] [187438] (2 PDB entries) |
![]() | Domain d2b2da_: 2b2d A: [162973] automated match to d1u1ya_ protein/RNA complex; mutant |
PDB Entry: 2b2d (more details), 2.9 Å
SCOPe Domain Sequences for d2b2da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b2da_ d.85.1.1 (A:) automated matches {Enterobacteria phage [TaxId: 12022]} asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti kvevpkvatqtvggvelpvaawrsylsmkltipifatnsdcelivkamqgllkdgnpips aiaansgiy
Timeline for d2b2da_: