Lineage for d2b20a2 (2b20 A:151-397)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the restSuperfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) 
many members have left-handed crossover connection between strand 8 and additional strand 9
Family c.69.1.2: Carboxylesterase [53487] (7 proteins) 
Protein Enterochelin esterase, catalytic domain [142699] (1 species) Species Shigella flexneri [TaxId:623] [142700] (4 PDB entries)
Uniprot Q83SB9 151-397
Domain d2b20a2: 2b20 A:151-397 [127686]
Other proteins in same PDB: d2b20a1
complexed with tla
Details for d2b20a2
PDB Entry: 2b20 (more details), 2.95 Å
PDB Description: Crystal Structure of Enterochelin Esterase from Shigella flexneri Enterochelin Esterase
PDB Compounds: (A:) enterochelin esteraseSCOPe Domain Sequences for d2b20a2:
Sequence, based on SEQRES records: (download)
>d2b20a2 c.69.1.2 (A:151-397) Enterochelin esterase, catalytic domain {Shigella flexneri [TaxId: 623]}
lqpgwdcpqapeipakeiiwkserlknsrrvwifttgdvtaeerplavlldgefwaqsmp
vwpvltslthrqqlppavyvlidaidtthrahelpcnadfwlavqqellplvkviapfsd
radrtvvagqsfgglsalyaglhwperfgcvlsqsgsywwphrggqqegvlleklkagev
saeglrivleagirepmimranqalyaqlhpikesifwrqvdgghdalcwrgglmqglid
lwqplfh
Sequence, based on observed residues (ATOM records): (download)
>d2b20a2 c.69.1.2 (A:151-397) Enterochelin esterase, catalytic domain {Shigella flexneri [TaxId: 623]}
lqpgwdcpqapeipakeiiwkserlknsrrvwifttgdvterplavlldgefwaqsmpvw
pvltslthrqqlppavyvlidaidtthrahelpcnadfwlavqqellplvkviapfsdra
drtvvagqsfgglsalyaglhwperfgcvlsqsgsywwphrggqqegvlleklkagevsa
eglrivleagirepmimranqalyaqlhpikesifwrqvdgghdalcwrgglmqglidlw
qplfh
SCOPe Domain Coordinates for d2b20a2:
Click to download the PDB-style file with coordinates for d2b20a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2b20a2:
- d2b20a2 first appeared in SCOP 1.73
- d2b20a2 appears in SCOPe 2.02
- d2b20a2 appears in SCOPe 2.04
- d2b20a2 appears in the current release, SCOPe 2.08
View in 3D
