Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (23 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.20: Enterochelin esterase N-terminal domain-like [141030] (1 protein) PfamB PB013071 |
Protein Enterochelin esterase [141031] (2 species) |
Species Shigella flexneri [TaxId:623] [141032] (1 PDB entry) Uniprot Q83SB9 3-150 |
Domain d2b20a1: 2b20 A:3-150 [127685] Other proteins in same PDB: d2b20a2 complexed with tla |
PDB Entry: 2b20 (more details), 2.95 Å
SCOP Domain Sequences for d2b20a1:
Sequence, based on SEQRES records: (download)
>d2b20a1 b.1.18.20 (A:3-150) Enterochelin esterase {Shigella flexneri [TaxId: 623]} alkvgseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdhhqn sqpqsmqriagtdvwqwttqlnanwrgsycfipterddifsapspdrlelregwrkllpq aiadplnpqswkgglghavsalempqap
>d2b20a1 b.1.18.20 (A:3-150) Enterochelin esterase {Shigella flexneri [TaxId: 623]} alkvgseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdhhqq pqsmqriagtdvwqwttqlnanwrgsycfipterddifsapspdrlelregwrkllpqai adplnpqswkgglghavsalempqap
Timeline for d2b20a1: