Lineage for d2b20a1 (2b20 A:3-150)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strandsSuperfamily b.1.18: E set domains [81296] (27 families) 
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.20: Enterochelin esterase N-terminal domain-like [141030] (1 protein)
PfamB PB013071
automatically mapped to Pfam PF11806Protein Enterochelin esterase [141031] (1 species) Species Shigella flexneri 2a str. 2457T [TaxId:198215] [141032] (4 PDB entries)
Uniprot Q83SB9 3-150
Domain d2b20a1: 2b20 A:3-150 [127685]
Other proteins in same PDB: d2b20a2
complexed with tla
Details for d2b20a1
PDB Entry: 2b20 (more details), 2.95 Å
PDB Description: Crystal Structure of Enterochelin Esterase from Shigella flexneri Enterochelin Esterase
PDB Compounds: (A:) enterochelin esteraseSCOPe Domain Sequences for d2b20a1:
Sequence, based on SEQRES records: (download)
>d2b20a1 b.1.18.20 (A:3-150) Enterochelin esterase {Shigella flexneri 2a str. 2457T [TaxId: 198215]}
alkvgseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdhhqn
sqpqsmqriagtdvwqwttqlnanwrgsycfipterddifsapspdrlelregwrkllpq
aiadplnpqswkgglghavsalempqap
Sequence, based on observed residues (ATOM records): (download)
>d2b20a1 b.1.18.20 (A:3-150) Enterochelin esterase {Shigella flexneri 2a str. 2457T [TaxId: 198215]}
alkvgseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdhhqq
pqsmqriagtdvwqwttqlnanwrgsycfipterddifsapspdrlelregwrkllpqai
adplnpqswkgglghavsalempqap
SCOPe Domain Coordinates for d2b20a1:
Click to download the PDB-style file with coordinates for d2b20a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2b20a1:
- d2b20a1 first appeared in SCOP 1.73
- d2b20a1 appears in SCOPe 2.07
View in 3D
