Lineage for d2b0va1 (2b0v A:4-149)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.113: Nudix [55810] (1 superfamily)
beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
contains beta-grasp motifSuperfamily d.113.1: Nudix [55811] (8 families) 
Family d.113.1.1: MutT-like [55812] (17 proteins) 
Protein Hypothetical protein NE0184 [143760] (1 species) Species Nitrosomonas europaea [TaxId:915] [143761] (1 PDB entry)
Uniprot Q82XR9 4-149
Domain d2b0va1: 2b0v A:4-149 [127650]
Other proteins in same PDB: d2b0va2
complexed with cl, edo, na
Details for d2b0va1
PDB Entry: 2b0v (more details), 1.55 Å
PDB Description: nudix hydrolase from nitrosomonas europaea.
PDB Compounds: (A:) NUDIX hydrolaseSCOPe Domain Sequences for d2b0va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]}
kpnvtvaavieqddkyllveeiprgtaiklnqpaghlepgesiiqacsrevleetghsfl
pevltgiyhwtcasngttylrftfsgqvvsfdpdrkldtgivraawfsideirakqamhr
tplvmqciedyhagkrypldilqyyd
SCOPe Domain Coordinates for d2b0va1:
Click to download the PDB-style file with coordinates for d2b0va1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2b0va1:
- d2b0va1 first appeared in SCOP 1.73
- d2b0va1 appears in SCOPe 2.07
View in 3D
