Lineage for d2b0oe1 (2b0o E:423-544)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.45: ArfGap/RecO-like zinc finger [57862] (1 superfamily)
    zinc-bound alpha+beta motif
  4. Superfamily g.45.1: ArfGap/RecO-like zinc finger [57863] (3 families) (S)
  5. Family g.45.1.0: automated matches [227161] (1 protein)
    not a true family
  6. Protein automated matches [226869] (1 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [225018] (1 PDB entry)
  8. Domain d2b0oe1: 2b0o E:423-544 [203519]
    Other proteins in same PDB: d2b0oe2, d2b0of2, d2b0og2, d2b0oh2
    automated match to d1dcqa2
    complexed with zn

Details for d2b0oe1

PDB Entry: 2b0o (more details), 2.06 Å

PDB Description: Crystal structure of UPLC1 GAP domain
PDB Compounds: (E:) uplc1

SCOPe Domain Sequences for d2b0oe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b0oe1 g.45.1.0 (E:423-544) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dltklliaevksrpgnsqccdcgaadptwlstnlgvltciqcsgvhrelgvrfsrmqslt
ldllgpselllalnmgntsfnevmeaqlpshggpkpsaesdmgtrrdyimakyvehrfar
rc

SCOPe Domain Coordinates for d2b0oe1 are not available.

Timeline for d2b0oe1:

Domains from same chain:
(mouse over for more information)
d2b0oe2
Domains from other chains:
(mouse over for more information)
d2b0of1, d2b0of2, d2b0og1, d2b0og2, d2b0oh1, d2b0oh2