Lineage for d2aytb2 (2ayt B:122-231)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1370148Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1370149Protein automated matches [190056] (107 species)
    not a true protein
  7. 1370210Species Aquifex aeolicus [TaxId:63363] [225093] (1 PDB entry)
  8. 1370214Domain d2aytb2: 2ayt B:122-231 [203518]
    automated match to d1a8la2
    complexed with gol, so4

Details for d2aytb2

PDB Entry: 2ayt (more details), 2.4 Å

PDB Description: The crystal structure of a protein disulfide oxidoreductase from aquifex aeolicus
PDB Compounds: (B:) glutaredoxin-like protein

SCOPe Domain Sequences for d2aytb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aytb2 c.47.1.0 (B:122-231) automated matches {Aquifex aeolicus [TaxId: 63363]}
qlsektlellqvvdipieiwvfvttscgycpsaavmawdfalandyitskvidasenqdl
aeqfqvvgvpkivinkgvaefvgaqpenaflgyimavyeklkrekeqale

SCOPe Domain Coordinates for d2aytb2:

Click to download the PDB-style file with coordinates for d2aytb2.
(The format of our PDB-style files is described here.)

Timeline for d2aytb2:

1370214
d2aytb2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2aytb1