Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily) beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins) an RNA-binding domain |
Protein Poly(RC)-binding protein 2 [143220] (1 species) contains three KH domains |
Species Human (Homo sapiens) [TaxId:9606] [143221] (4 PDB entries) Uniprot Q15366 11-81 |
Domain d2axya1: 2axy A:11-81 [127532] 1st KH domain protein/DNA complex |
PDB Entry: 2axy (more details), 1.7 Å
SCOPe Domain Sequences for d2axya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} nvtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaifk afamiidklee
Timeline for d2axya1: