Lineage for d2axti1 (2axt I:1-35)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026703Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) (S)
    automatically mapped to Pfam PF02532
  5. 3026704Family f.23.37.1: PsbI-like [161042] (1 protein)
    Pfam PF02532
  6. 3026705Protein Photosystem II reaction center protein I, PsbI [161043] (3 species)
  7. 3026706Species Thermosynechococcus elongatus [TaxId:146786] [161044] (7 PDB entries)
    Uniprot Q8DJZ6 1-35
  8. 3026713Domain d2axti1: 2axt I:1-35 [144933]
    Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv_, d2axtz1
    complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk

Details for d2axti1

PDB Entry: 2axt (more details), 3 Å

PDB Description: crystal structure of photosystem ii from thermosynechococcus elongatus
PDB Compounds: (I:) Photosystem II reaction center I protein

SCOPe Domain Sequences for d2axti1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axti1 f.23.37.1 (I:1-35) Photosystem II reaction center protein I, PsbI {Thermosynechococcus elongatus [TaxId: 146786]}
metlkitvyivvtffvllfvfgflsgdparnpkrk

SCOPe Domain Coordinates for d2axti1:

Click to download the PDB-style file with coordinates for d2axti1.
(The format of our PDB-style files is described here.)

Timeline for d2axti1: