Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) automatically mapped to Pfam PF02532 |
Family f.23.37.1: PsbI-like [161042] (1 protein) Pfam PF02532 |
Protein Photosystem II reaction center protein I, PsbI [161043] (3 species) |
Species Thermosynechococcus elongatus [TaxId:146786] [161044] (7 PDB entries) Uniprot Q8DJZ6 1-35 |
Domain d2axti1: 2axt I:1-35 [144933] Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv_, d2axtz1 complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk |
PDB Entry: 2axt (more details), 3 Å
SCOPe Domain Sequences for d2axti1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axti1 f.23.37.1 (I:1-35) Photosystem II reaction center protein I, PsbI {Thermosynechococcus elongatus [TaxId: 146786]} metlkitvyivvtffvllfvfgflsgdparnpkrk
Timeline for d2axti1: