Lineage for d2axpa1 (2axp A:2-165)
- Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
parallel beta-sheet of 5 strands, order 23145
Protein Hypothetical protein YorR [142211] (1 species) Species Bacillus subtilis [TaxId:1423] [142212] (1 PDB entry)
Uniprot O31896 2-165
Domain d2axpa1: 2axp A:2-165 [127497]
Details for d2axpa1
PDB Entry: 2axp (more details), 2.5 Å
PDB Description: X-Ray Crystal Structure of Protein BSU20280 from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR256.
PDB Compounds: (A:) hypothetical protein BSU20280SCOPe Domain Sequences for d2axpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axpa1 c.37.1.1 (A:2-165) Hypothetical protein YorR {Bacillus subtilis [TaxId: 1423]}
tliilegpdccfkstvaaklskelkypiikgssfelaksgneklfehfnkladednviid
rfvysnlvyakkfkdysilterqlrfiedkikakakvvylhadpsvikkrlrvrgdeyie
gkdidsilelyrevmsnaglhtyswdtgqwssdeiakdiiflve
SCOPe Domain Coordinates for d2axpa1:
Click to download the PDB-style file with coordinates for d2axpa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2axpa1:
- d2axpa1 first appeared in SCOP 1.73
- d2axpa1 appears in SCOP 1.75
- d2axpa1 appears in SCOPe 2.02
- d2axpa1 appears in the current release, SCOPe 2.08
View in 3D
