Lineage for d2awta_ (2awt A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2538336Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2539528Protein automated matches [190118] (17 species)
    not a true protein
  7. 2539567Species Human (Homo sapiens) [TaxId:9606] [189560] (114 PDB entries)
  8. 2539780Domain d2awta_: 2awt A: [127475]
    automated match to d1wz0a1

Details for d2awta_

PDB Entry: 2awt (more details)

PDB Description: solution structure of human small ubiquitin-like modifier protein isoform 2 (sumo-2)
PDB Compounds: (A:) Small ubiquitin-related modifier 2

SCOPe Domain Sequences for d2awta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2awta_ d.15.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
madekpkegvktenndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirf
rfdgqpinetdtpaqlemededtidvfqqqtggvy

SCOPe Domain Coordinates for d2awta_:

Click to download the PDB-style file with coordinates for d2awta_.
(The format of our PDB-style files is described here.)

Timeline for d2awta_: