| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
| Family a.35.1.11: PrgX N-terminal domain-like [140526] (1 protein) Part of Pfam PF01381 |
| Protein PrgX [140527] (1 species) possibly involved in pheromone-inducible conjugation |
| Species Enterococcus faecalis [TaxId:1351] [140528] (4 PDB entries) Uniprot Q04114 1-69! Uniprot Q04114 2-66 |
| Domain d2aw6a1: 2aw6 A:1-69 [127408] Other proteins in same PDB: d2aw6a2, d2aw6b1, d2aw6b2 protein/DNA complex |
PDB Entry: 2aw6 (more details), 3 Å
SCOPe Domain Sequences for d2aw6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aw6a1 a.35.1.11 (A:1-69) PrgX {Enterococcus faecalis [TaxId: 1351]}
mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
ilnragmnt
Timeline for d2aw6a1: