Lineage for d2aw6a1 (2aw6 A:1-69)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1732724Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1732725Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1733130Family a.35.1.11: PrgX N-terminal domain-like [140526] (1 protein)
    Part of Pfam PF01381
  6. 1733131Protein PrgX [140527] (1 species)
    possibly involved in pheromone-inducible conjugation
  7. 1733132Species Enterococcus faecalis [TaxId:1351] [140528] (4 PDB entries)
    Uniprot Q04114 1-69! Uniprot Q04114 2-66
  8. 1733157Domain d2aw6a1: 2aw6 A:1-69 [127408]
    Other proteins in same PDB: d2aw6a2, d2aw6b1, d2aw6b2
    protein/DNA complex

Details for d2aw6a1

PDB Entry: 2aw6 (more details), 3 Å

PDB Description: structure of a bacterial peptide pheromone/receptor complex and its mechanism of gene regulation
PDB Compounds: (A:) PrgX

SCOPe Domain Sequences for d2aw6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aw6a1 a.35.1.11 (A:1-69) PrgX {Enterococcus faecalis [TaxId: 1351]}
mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
ilnragmnt

SCOPe Domain Coordinates for d2aw6a1:

Click to download the PDB-style file with coordinates for d2aw6a1.
(The format of our PDB-style files is described here.)

Timeline for d2aw6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aw6a2