Lineage for d2aw0a_ (2aw0 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560728Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2560729Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 2560818Protein Menkes copper-transporting ATPase [55012] (1 species)
  7. 2560819Species Human (Homo sapiens) [TaxId:9606] [55013] (7 PDB entries)
  8. 2560820Domain d2aw0a_: 2aw0 A: [39341]
    4th metal-binding domain
    complexed with ag

Details for d2aw0a_

PDB Entry: 2aw0 (more details)

PDB Description: fourth metal-binding domain of the menkes copper-transporting atpase, nmr, 20 structures
PDB Compounds: (A:) menkes copper-transporting ATPase

SCOPe Domain Sequences for d2aw0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}
ltqetvinidgmtcnscvqsiegviskkpgvksirvslansngtveydplltspetlrga
iedmgfdatlsd

SCOPe Domain Coordinates for d2aw0a_:

Click to download the PDB-style file with coordinates for d2aw0a_.
(The format of our PDB-style files is described here.)

Timeline for d2aw0a_: