Lineage for d2avna1 (2avn A:1-246)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2501729Family c.66.1.41: UbiE/COQ5-like [110671] (5 proteins)
    Pfam PF01209
  6. 2501730Protein Hypothetical methyltransferase TM1389 [142595] (1 species)
  7. 2501731Species Thermotoga maritima [TaxId:2336] [142596] (1 PDB entry)
    Uniprot Q9X1A9 1-246
  8. 2501732Domain d2avna1: 2avn A:1-246 [127380]
    Other proteins in same PDB: d2avna2, d2avnb3
    complexed with po4, sai

Details for d2avna1

PDB Entry: 2avn (more details), 2.35 Å

PDB Description: crystal structure of a ubiquinone/menaquinone biosynthesis methyltransferase-related protein (tm1389) from thermotoga maritima msb8 at 2.35 a resolution
PDB Compounds: (A:) ubiquinone/menaquinone biosynthesis methyltransferase-related protein

SCOPe Domain Sequences for d2avna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]}
mklrswefydriaraydsmyetpkwklyhrligsfleeylknpcrvldlgggtgkwslfl
qergfevvlvdpskemlevarekgvknvveakaedlpfpsgafeavlalgdvlsyvenkd
kafseirrvlvpdglliatvdnfytflqqmiekdawdqitrflktqttsvgttlfsfnsy
afkpedldslegfetvdirgigvmeypderisereetifrleqelsrdrniiwkadhiff
vlkkkr

SCOPe Domain Coordinates for d2avna1:

Click to download the PDB-style file with coordinates for d2avna1.
(The format of our PDB-style files is described here.)

Timeline for d2avna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2avna2