Lineage for d2av0a1 (2av0 A:2-146)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly openedSuperfamily a.1.1: Globin-like [46458] (4 families) 
Family a.1.1.2: Globins [46463] (26 proteins)
Heme-binding protein
Protein Hemoglobin I [46464] (2 species) 
Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (17 PDB entries) 
Domain d2av0a1: 2av0 A:2-146 [127347]
automatically matched to d2hbia_
complexed with cmo, hem; mutant
Details for d2av0a1
PDB Entry: 2av0 (more details), 1.5 Å
PDB Description: f97l with co bound
PDB Compounds: (A:) Globin ISCOP Domain Sequences for d2av0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2av0a1 a.1.1.2 (A:2-146) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvveklavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal
SCOP Domain Coordinates for d2av0a1:
Click to download the PDB-style file with coordinates for d2av0a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2av0a1:
- d2av0a1 first appeared in SCOP 1.73
- d2av0a1 is called d2av0a_ in SCOPe 2.01
- d2av0a1 appears in the current release, SCOPe 2.08, called d2av0a_
View in 3D
