Lineage for d2atxb_ (2atx B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. Protein RhoQ [142261] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [142262] (1 PDB entry)
    Uniprot P17081 1-185
  8. Domain d2atxb_: 2atx B: [127316]
    automated match to d2atxa1
    complexed with gnp, mg

Details for d2atxb_

PDB Entry: 2atx (more details), 2.65 Å

PDB Description: crystal structure of the tc10 gppnhp complex
PDB Compounds: (B:) small GTP binding protein TC10

SCOPe Domain Sequences for d2atxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2atxb_ c.37.1.8 (B:) RhoQ {Human (Homo sapiens) [TaxId: 9606]}
smahgpgalmlkcvvvgdgavgktcllmsyandafpeeyvptvfdhyavsvtvggkqyll
glydtagqedydrlrplsypmtdvflicfsvvnpasfqnvkeewvpelkeyapnvpflli
gtqidlrddpktlarlndmkekpicveqgqklakeigaccyvecsaltqkglktvfdeai
iailtp

SCOPe Domain Coordinates for d2atxb_ are not available.

Timeline for d2atxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2atxa1