Lineage for d2atxa1 (2atx A:9-193)
- Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (79 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein RhoQ [142261] (1 species) Species Human (Homo sapiens) [TaxId:9606] [142262] (1 PDB entry)
Uniprot P17081 1-185
Domain d2atxa1: 2atx A:9-193 [127315]
complexed with gnp, mg
Details for d2atxa1
PDB Entry: 2atx (more details), 2.65 Å
PDB Description: crystal structure of the tc10 gppnhp complex
PDB Compounds: (A:) small GTP binding protein TC10SCOPe Domain Sequences for d2atxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]}
mahgpgalmlkcvvvgdgavgktcllmsyandafpeeyvptvfdhyavsvtvggkqyllg
lydtagqedydrlrplsypmtdvflicfsvvnpasfqnvkeewvpelkeyapnvpfllig
tqidlrddpktlarlndmkekpicveqgqklakeigaccyvecsaltqkglktvfdeaii
ailtp
SCOPe Domain Coordinates for d2atxa1:
Click to download the PDB-style file with coordinates for d2atxa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2atxa1:
- d2atxa1 first appeared in SCOP 1.73
- d2atxa1 appears in SCOP 1.75
- d2atxa1 appears in SCOPe 2.02
- d2atxa1 appears in the current release, SCOPe 2.08
View in 3D
