Lineage for d2asya1 (2asy A:1-101)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) 
dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
Family d.58.4.12: Hypothetical protein YdhR [117940] (2 proteins)
automatically mapped to Pfam PF08803Protein Hypothetical protein YdhR [117941] (1 species) Species Escherichia coli [TaxId:562] [117942] (3 PDB entries)
Uniprot P77225
Domain d2asya1: 2asy A:1-101 [127278]
Details for d2asya1
PDB Entry: 2asy (more details)
PDB Description: solution structure of ydhr protein from escherichia coli
PDB Compounds: (A:) Protein ydhR precursorSCOPe Domain Sequences for d2asya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2asya1 d.58.4.12 (A:1-101) Hypothetical protein YdhR {Escherichia coli [TaxId: 562]}
matllqlhfafngpfgdamaeqlkplaesinqepgflwkvwteseknheaggiylftdek
salaylekhtarlknlgveevvakvfdvneplsqinqakla
SCOPe Domain Coordinates for d2asya1:
Click to download the PDB-style file with coordinates for d2asya1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2asya1:
- d2asya1 first appeared in SCOP 1.73
- d2asya1 appears in SCOPe 2.04
- d2asya1 appears in SCOPe 2.06
- d2asya1 appears in the current release, SCOPe 2.08
View in 3D
