Lineage for d2aska_ (2ask A:)
- Root: SCOPe 2.07
Class g: Small proteins [56992] (98 folds) 
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
disulfide-rich fold; common core is all-betaSuperfamily g.17.1: Cystine-knot cytokines [57501] (8 families) 
Family g.17.1.0: automated matches [191392] (1 protein)
not a true familyProtein automated matches [190506] (3 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187459] (38 PDB entries) 
Domain d2aska_: 2ask A: [197760]
automated match to d2askb_
complexed with so4
Details for d2aska_
PDB Entry: 2ask (more details), 1.55 Å
PDB Description: Structure of human Artemin
PDB Compounds: (A:) arteminSCOPe Domain Sequences for d2aska_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aska_ g.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
argcrlrsqlvpvralglghrsdelvrfrfcsgscrrarsphdlslasllgagalrpppg
srpvsqpccrptryeavsfmdvnstwrtvdrlsatacgclg
SCOPe Domain Coordinates for d2aska_:
Click to download the PDB-style file with coordinates for d2aska_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2aska_:
- d2aska_ first appeared in SCOPe 2.03
- d2aska_ appears in SCOPe 2.06
- d2aska_ appears in the current release, SCOPe 2.08
View in 3D
