Lineage for d2as8a1 (2as8 A:1-222)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926889Protein Major mite fecal allergen der p 1 [142848] (1 species)
  7. 2926890Species House-dust mite (Dermatophagoides pteronyssinus) [TaxId:6956] [142849] (3 PDB entries)
    Uniprot P08176 19-320! Uniprot P08176 99-320
  8. 2926894Domain d2as8a1: 2as8 A:1-222 [127242]
    complexed with mg

Details for d2as8a1

PDB Entry: 2as8 (more details), 1.95 Å

PDB Description: crystal structure of mature and fully active der p 1 allergen
PDB Compounds: (A:) Major mite fecal allergen Der p 1

SCOPe Domain Sequences for d2as8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2as8a1 d.3.1.1 (A:1-222) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]}
tnacsingnapaeidlrqmrtvtpirmqggcgscwafsgvaatesaylayrqqsldlaeq
elvdcasqhgchgdtiprgieyiqhngvvqesyyryvareqscrrpnaqrfgisnycqiy
ppnankirealaqthsaiaviigikdldafrhydgrtiiqrdngyqpnyhavnivgysna
qgvdywivrnswdtnwgdngygyfaanidlmmieeypyvvil

SCOPe Domain Coordinates for d2as8a1:

Click to download the PDB-style file with coordinates for d2as8a1.
(The format of our PDB-style files is described here.)

Timeline for d2as8a1: