Lineage for d2as0a2 (2as0 A:73-396)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1378488Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1378489Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1379540Family c.66.1.51: hypothetical RNA methyltransferase [142635] (4 proteins)
    C-terminal part of Pfam PF03602; similar to (Uracil-5-)-methyltransferase (Pfam PF05958)
  6. 1379541Protein Hypothetical protein PH1915, middle and C-terminal domains [142642] (1 species)
  7. 1379542Species Pyrococcus horikoshii [TaxId:53953] [142643] (1 PDB entry)
    Uniprot O59578 73-396
  8. 1379543Domain d2as0a2: 2as0 A:73-396 [127228]
    Other proteins in same PDB: d2as0a1, d2as0b1

Details for d2as0a2

PDB Entry: 2as0 (more details), 1.8 Å

PDB Description: Crystal Structure of PH1915 (APC 5817): A Hypothetical RNA Methyltransferase
PDB Compounds: (A:) hypothetical protein PH1915

SCOPe Domain Sequences for d2as0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Pyrococcus horikoshii [TaxId: 53953]}
inkdlfkrrikkaneyrkkvlkytnvyrmvygeadylpglivdrfndiaslqissagmer
fkldvaeaimevepgietvfekntgrsrrreglpeiervllgkekyrtiiqegrakfivd
mrgqktgffldqrenrlalekwvqpgdrvldvftytggfaihaaiagadevigidkspra
ietakenaklngvedrmkfivgsafeemeklqkkgekfdivvldppafvqhekdlkaglr
ayfnvnfaglnlvkdggilvtcscsqhvdlqmfkdmiiaagakagkflkmlepyrtqapd
hpilmaskdteylkclflyvedmr

SCOPe Domain Coordinates for d2as0a2:

Click to download the PDB-style file with coordinates for d2as0a2.
(The format of our PDB-style files is described here.)

Timeline for d2as0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2as0a1