Class b: All beta proteins [48724] (176 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) related to the ferredoxin reductase-like FAD-binding domain |
Family b.45.1.1: PNP-oxidase like [50476] (17 proteins) |
Protein Hypothetical protein PA4388 [141350] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [141351] (1 PDB entry) Uniprot Q9HW16 2-239 |
Domain d2arza1: 2arz A:2-239 [127225] Other proteins in same PDB: d2arzb_ complexed with cl, gol |
PDB Entry: 2arz (more details), 2 Å
SCOPe Domain Sequences for d2arza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2arza1 b.45.1.1 (A:2-239) Hypothetical protein PA4388 {Pseudomonas aeruginosa [TaxId: 287]} sveaaknarelllkeyravlsthskkwpgfpfgsvvpycldaegrplilisriaqhthnl qadprcsmlvgergaediqavgrltllaearqlaeeevaaaaeryyryfpesadyhrvhd fdfwvlqpvqwrfiggfgaihwlaaervplanpfageaergmvehmnsdhaaaiahyvel aglpahaaaqlagidtegfhlrigqglhwlpfpaacgnpgavrqalvqlaraerwptv
Timeline for d2arza1: