| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
| Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
| Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species) |
| Species Actinobacillus pleuropneumoniae [TaxId:715] [49340] (1 PDB entry) |
| Domain d2apsa_: 2aps A: [22298] complexed with cu, zn |
PDB Entry: 2aps (more details), 1.9 Å
SCOPe Domain Sequences for d2apsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2apsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Actinobacillus pleuropneumoniae [TaxId: 715]}
eklvvqvqqldpvkgnkdvgtveitesayglvftphlhglaqglhgfhihqnpscepkek
dgklvaglgagghwdpketkqhgypwsdnahlgdlpalfvehdgsatnpvlaprlkklde
vkghslmiheggdnhsdhpaplggggprmacgvik
Timeline for d2apsa_: