Lineage for d2apsa_ (2aps A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) 
has additional strand at N-terminusFamily b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) 
Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species) 
Species Actinobacillus pleuropneumoniae [TaxId:715] [49340] (1 PDB entry) 
Domain d2apsa_: 2aps A: [22298]
complexed with cu, zn
Details for d2apsa_
PDB Entry: 2aps (more details), 1.9 Å
PDB Description: cu/zn superoxide dismutase from actinobacillus pleuropneumoniae
PDB Compounds: (A:) protein (cu,zn superoxide dismutase)SCOPe Domain Sequences for d2apsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2apsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Actinobacillus pleuropneumoniae [TaxId: 715]}
eklvvqvqqldpvkgnkdvgtveitesayglvftphlhglaqglhgfhihqnpscepkek
dgklvaglgagghwdpketkqhgypwsdnahlgdlpalfvehdgsatnpvlaprlkklde
vkghslmiheggdnhsdhpaplggggprmacgvik
SCOPe Domain Coordinates for d2apsa_:
Click to download the PDB-style file with coordinates for d2apsa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2apsa_:
- d2apsa_ first appeared (with stable ids) in SCOP 1.55
- d2apsa_ appears in SCOPe 2.07
View in 3D
