Lineage for d2ap1a1 (2ap1 A:118-303)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884593Family c.55.1.10: ROK [110636] (8 proteins)
    Pfam PF00480
  6. 2884638Protein Putative regulator protein YcfX [142475] (1 species)
  7. 2884639Species Salmonella typhimurium [TaxId:90371] [142476] (1 PDB entry)
    Uniprot Q8ZPZ9 1-117! Uniprot Q8ZPZ9 118-303
  8. 2884640Domain d2ap1a1: 2ap1 A:118-303 [127108]
    Other proteins in same PDB: d2ap1a3
    complexed with na, zn

Details for d2ap1a1

PDB Entry: 2ap1 (more details), 1.9 Å

PDB Description: crystal structure of the putative regulatory protein
PDB Compounds: (A:) putative regulator protein

SCOPe Domain Sequences for d2ap1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ap1a1 c.55.1.10 (A:118-303) Putative regulator protein YcfX {Salmonella typhimurium [TaxId: 90371]}
eftqyplvmglilgtgvggglvlngkpitgqsyitgefghmrlpvdaltlmgfdfplrrc
gcgqmgcienylsgrgfawlyqhyydqslqapeiialweqgdeqahahveryldllavcl
gniltivdpdllviggglsnftaittqlaerlprhllpvaraprierarhgdaggmrgaa
flhltd

SCOPe Domain Coordinates for d2ap1a1:

Click to download the PDB-style file with coordinates for d2ap1a1.
(The format of our PDB-style files is described here.)

Timeline for d2ap1a1: