Lineage for d2aoub_ (2aou B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the restSuperfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) 
Family c.66.1.19: Histamine methyltransferase [75261] (1 protein) Protein Histamine methyltransferase [75262] (1 species) Species Human (Homo sapiens) [TaxId:9606] [75263] (7 PDB entries) 
Domain d2aoub_: 2aou B: [127101]
automated match to d1jqda_
complexed with cqa
Details for d2aoub_
PDB Entry: 2aou (more details), 2.3 Å
PDB Description: Histamine Methyltransferase Complexed with the Antimalarial Drug Amodiaquine
PDB Compounds: (B:) Histamine N-methyltransferaseSCOPe Domain Sequences for d2aoub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aoub_ c.66.1.19 (B:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]}
smrslfsdhgkyvesfrrflnhstehqcmqefmdkklpgiigrigdtkseikilsiggga
geidlqilskvqaqypgvcinnevvepsaeqiakykelvaktsnlenvkfawhketssey
qsrmlekkelqkwdfihmiqmlyyvkdipatlkffhsllgtnakmliivvsgssgwdklw
kkygsrfpqddlcqyitsddltqmldnlglkyecydllstmdisdcfidgnengdllwdf
ltetcnfnatappdlraelgkdlqepefsakkegkvlfnntlsfiviea
SCOPe Domain Coordinates for d2aoub_:
Click to download the PDB-style file with coordinates for d2aoub_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2aoub_:
- d2aoub_ first appeared in SCOP 1.73, called d2aoub1
- d2aoub_ appears in SCOPe 2.07
View in 3D
