Lineage for d2ania_ (2ani A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703608Protein automated matches [190435] (12 species)
    not a true protein
  7. 2703625Species Chlamydia trachomatis [TaxId:813] [225098] (5 PDB entries)
  8. 2703638Domain d2ania_: 2ani A: [203477]
    automated match to d1syya_
    complexed with fe, pb; mutant

Details for d2ania_

PDB Entry: 2ani (more details), 2 Å

PDB Description: crystal structure of the f127y mutant of ribonucleotide reductase r2 from chlamydia trachomatis
PDB Compounds: (A:) Ribonucleoside-diphosphate reductase beta subunit

SCOPe Domain Sequences for d2ania_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ania_ a.25.1.2 (A:) automated matches {Chlamydia trachomatis [TaxId: 813]}
qadildgkqkrvnlnskrlvncnqvdvnqlvpikykwawehylngcannwlpteipmgkd
ielwksdrlsederrvillnlgffstaeslvgnnivlaifkhvtnpearqyllrqafeea
vhthtylyiceslgldekeifnayneraaikakddfqmeitgkvldpnfrtdsveglqef
vknlvgyyiimegiffysgfvmilsfhrqnkmigigeqyqyilrdetihlnfgidlingi
keenpeiwtpelqqeivelikravdleieyaqdclprgilglrasmfidyvqhiadrrle
riglkpiyhtknpfpwm

SCOPe Domain Coordinates for d2ania_:

Click to download the PDB-style file with coordinates for d2ania_.
(The format of our PDB-style files is described here.)

Timeline for d2ania_: